PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00005773-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 192aa    MW: 20933.1 Da    PI: 8.9543
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00005773-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.42.9e-161858747
                        HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        s +qv+fskRr g++KKA EL++ C++e   iifs+ gk++
  WALNUT_00005773-RA 18 SAQQVSFSKRRSGLFKKAGELCTICAVETDNIIFSPGGKVF 58
                        778***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-15463IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-18473IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.395464IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-10626IPR002100Transcription factor, MADS-box
PfamPF003199.5E-161859IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-102641IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-104162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MMNMGGKKTQ KKTMQGASAQ QVSFSKRRSG LFKKAGELCT ICAVETDNII FSPGGKVFSC  60
GHHSVEDVIN MLGHRGKPDA VSILEAEAHQ ERVLCDLKKQ YSDLLEQLEA EKKRGEKLEQ  120
MKKEGQVSSW FVTPIEELSF EELKIQHAAM AELRGKVLKN MAERLAQGSA PSVAANSGGA  180
SDFPVSKPKA AP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1639169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-32AGAMOUS-like 61